BD-2, Mouse
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


BD-2, Mouse
Description :
BD-2 Protein, Mouse is an anti-microbial peptide that participates in the response to microbial invasion.Product Name Alternative :
BD-2 Protein, Mouse, Mouse, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/bd-2-protein-mouse.htmlPurity :
98.0Smiles :
AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMKMolecular Formula :
13215 (Gene_ID) P82020 (A21-K71) (Accession)Molecular Weight :
Approximately 5.5 kDaReferences & Citations :
[1]Kwon JK, et al. Murine β-defensin-2 may regulate the effect of bacillus Calmette-Guérin (BCG) in normal mouse bladder. Urol Oncol. 2015 Mar;33 (3) :111.e9-16.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

