BD-3, Mouse

• Description :

  BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.

• Product Name Alternative :

  BD-3 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/bd-3-protein-mouse.html

• Purity :

  95.0

• Smiles :

  KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

• Molecular Formula :

  27358 (Gene_ID) Q9WTL0 (K23-K63) (Accession)

• Molecular Weight :

  Approximately 10.06 kDa

• References & Citations :

  [1]Bals R, et al. Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in the epithelia of multiple organs. Infect Immun. 1999 Jul;67 (7) :3542-7.|[2]Burd RS, et al. Murine beta-defensin-3 is an inducible peptide with limited tissue expression and broad-spectrum antimicrobial activity. Shock. 2002 Nov;18 (5) :461-4.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins