BD-3, Human

• Description:

  BD-3 Protein, Human is an antibacterial peptide that exhibits antibacterial activities towards Gram-negative and Gram-positive bacteria as well as an ability to act as a chemo-attractant.

• Product Name Alternative:

  BD-3 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/bd-3-protein-human.html

• Purity:

  98.0

• Smiles:

  GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK

• Molecular Formula:

  55894 (Gene_ID) P81534 (G23-K67) (Accession)

• Molecular Weight:

  Approximately 5.2 kDa

• References & Citations:

  [1]Dhople V, et al. The human beta-defensin-3, an antibacterial peptide with multiple biological functions. Biochim Biophys Acta. 2006 Sep;1758 (9) :1499-512.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins