BD-2, Human

• Description:

  BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.

• Product Name Alternative:

  BD-2 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/bd-2-protein-human.html

• Purity:

  98.00

• Smiles:

  GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

• Molecular Formula:

  1673 (Gene_ID) O15263 (G24-P64) (Accession)

• Molecular Weight:

  Approximately 4.3-9 kDa

• References & Citations:

  [1]Soto E, et al. Human beta-defensin-2: a natural antimicrobial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity. J Matern Fetal Neonatal Med. 2007 Jan;20 (1) :15-22.|[2]Harder J, et al. Mucoid Pseudomonas aeruginosa, TNF-alpha, and IL-1beta, but not IL-6, induce human beta-defensin-2 in respiratory epithelia. Am J Respir Cell Mol Biol. 2000 Jun;22 (6) :714-21.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins