BD-2, Human

CAT:
804-HY-P7135-01
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BD-2, Human - image 1

BD-2, Human

  • Description :

    BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.
  • Product Name Alternative :

    BD-2 Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/bd-2-protein-human.html
  • Purity :

    98.00
  • Smiles :

    GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
  • Molecular Formula :

    1673 (Gene_ID) O15263 (G24-P64) (Accession)
  • Molecular Weight :

    Approximately 4.3-9 kDa
  • References & Citations :

    [1]Soto E, et al. Human beta-defensin-2: a natural antimicrobial peptide present in amniotic fluid participates in the host response to microbial invasion of the amniotic cavity. J Matern Fetal Neonatal Med. 2007 Jan;20 (1) :15-22.|[2]Harder J, et al. Mucoid Pseudomonas aeruginosa, TNF-alpha, and IL-1beta, but not IL-6, induce human beta-defensin-2 in respiratory epithelia. Am J Respir Cell Mol Biol. 2000 Jun;22 (6) :714-21.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide