FGF-8c, Mouse

CAT:
804-HY-P7348
Size:
1 Each
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
FGF-8c, Mouse - image 1

FGF-8c, Mouse

  • Description :

    FGF-8c Protein, Mouse is an isoform of FGF-8, an essential factor during embryonic development, involved in the progression of prostate cancer.
  • Product Name Alternative :

    FGF-8c Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/fgf-8c-protein-mouse.html
  • Smiles :

    MQVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKNFTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
  • Molecular Formula :

    14179 (Gene_ID) P37237 (Q23-R268) (Accession)
  • Molecular Weight :

    Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
  • References & Citations :

    [1]Harpain F, et al. FGF8 induces therapy resistance in neoadjuvantly radiated rectal cancer. J Cancer Res Clin Oncol. 2019 Jan;145 (1) :77-86.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide