FGF-4, Mouse

• Description :

  The FGF-4 protein plays a key role in embryonic development and is central to cell proliferation and differentiation. It is essential for the survival of mouse embryos after implantation and is key to normal limb and heart valve development. FGF-4 Protein, Mouse is the recombinant mouse-derived FGF-4 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  FGF-4 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/fgf-4-protein-mouse.html

• Purity :

  99.90

• Smiles :

  SGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL

• Molecular Formula :

  14175 (Gene_ID) P11403 (S67-L202) (Accession)

• Molecular Weight :

  Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins