FGF-21, Mouse

• Description :

  FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

• Product Name Alternative :

  FGF-21 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Applications :

  Metabolism-protein/nucleotide metabolism

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/fgf-21-protein-mouse.html

• Purity :

  98.0

• Smiles :

  AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

• Molecular Formula :

  56636 (Gene_ID) Q9JJN1 (A29-S210) (Accession)

• Molecular Weight :

  Approximately 19-23 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Xu J, et al. Fibroblast growth factor 21 reverses hepatic steatosis, increases energy expenditure, and improves insulin sensitivity in diet-induced obese mice. Diabetes. 2009 Jan;58 (1) :250-9.|[2]Coskun T, et al. Fibroblast growth factor 21 corrects obesity in mice. Endocrinology. 2008 Dec;149 (12) :6018-27.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins