FGF-1, Mouse

• Description:

  FGF-1 Protein, Mouse is a growth factor and signaling protein encoded by the FGF1 gene.

• Product Name Alternative:

  FGF-1 Protein, Mouse, Mouse, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/fgf-1-protein-mouse.html

• Purity:

  98.00

• Smiles:

  FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

• Molecular Formula:

  14164 (Gene_ID) P61148 (F16-D155) (Accession)

• Molecular Weight:

  Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations:

  [1]La Rosa S, et al. Expression of acidic fibroblast growth factor (aFGF) and fibroblast growth factor receptor 4 (FGFR4) in breast fibroadenomas. J Clin Pathol. 2001 Jan;54 (1) :37-41.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins