Products for Research Use Only
RegisterLogin

FGF-9, Mouse (His)

CAT: 0804-HY-P7352A-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7352A-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
FGF-9 is a member of mouse heparin-binding fibroblast growth factors located on the outside of cell membranes. FGF-9 is a regulator of chondrogenesis and vascularization during bone development. FGF-9 binds to fibroblast growth factor receptors (FGFRs) to activate downstream signaling pathways, such as PI3K-AKT, RAS-MAPK and protein kinase C (PKC) pathways. FGF-9 regulates embryonic development, cell proliferation, cell differentiation and cell migration. FGF-9 plays an important role in differentiation, survival of neuronal cells and growth stimulation of glial tumors. FGF-9 Protein, Mouse (His) is a recombinant protein with a N-His label and is produced in E. coli[1][2][3][4][5].
Product Name Alternative
FGF-9 Protein, Mouse (His), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Related Pathways
Protein Tyrosine Kinase/RTK
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-9-protein-mouse-n-his.html
Purity
98.0
Smiles
APLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Molecular Formula
14180 (Gene_ID) P54130 (A2-S208) (Accession)
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Patzek S, et al. Loss of Fgf9 in mice leads to pancreatic hypoplasia and asplenia. iScience. 2023 Mar 25;26 (4) :106500. |[2]Pan YN, et al. Fibroblast growth factor 9 reduces TBHP-induced oxidative stress in chondrocytes and diminishes mouse osteoarthritis by activating ERK/Nrf2 signaling pathway. Int Immunopharmacol. 2023 Jan;114:109606.|[3]Li A, et al. Fibroblast growth factor 9 attenuates sepsis-induced fulminant hepatitis in mice. Amino Acids. 2022 Jul;54 (7) :1069-1081.|[4]Li R, Sun Y, et al. The Fibroblast Growth Factor 9 (Fgf9) Participates in Palatogenesis by Promoting Palatal Growth and Elevation. Front Physiol. 2021 Apr 20;12:653040.|[5]Ganji E, et al. Targeted deletion of Fgf9 in tendon disrupts mineralization of the developing enthesis. FASEB J. 2023 Mar;37 (3) :e22777. doi: 10.1096/fj.202201614R. Erratum in: FASEB J. 2023 Apr;37 (4) :e22856.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P705419FGF-9, Human (HEK293, His)
HY-P700071AF-01Animal-Free FGF-9, Human (His)
HY-P7351FGF-9 (CHO-expressed), Mouse
HY-P7178-01FGF-9, Rat
HY-P7177-01FGF-9, Human
HY-P7348A-01FGF-8c, Mouse (His)
HY-P73052-01FGF-2, Mouse (His)
HY-P704167FGF-20, Mouse (His)
HY-P72653-01FGF-17, Mouse (His)
HY-P71526-01FGF-15, Mouse (His-SUMO)

Alternative Products

CatalogName
Z03575-100FGF-9, His, Mouse
TMPJ-01011-01FGF-9 Protein, Mouse, Recombinant (His)
P515184FGF-9; FGF9 Protein (N-His, Mouse)
MOP2157-01Recombinant Mouse Fgf-9 Protein, His Tag
MBS1560783-01Recombinant Mouse FGF-9 protein, C-His Tag
PKSM041022-01Recombinant Mouse FGF-9/FGF9 Protein (His Tag)
OM300851-01FGF 21 Mouse, His
OM300893-01FGF 1 Mouse, His
GTR18985500-01Mouse FGF 1 (His) Protein
TMPY-00210-01FGF-2 Protein, Mouse, Recombinant (His)

Popular Products