BD-1, Rat

CAT: 0804-HY-P7134-01Size: 5 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P7134-01Size:5 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

BD-1 Protein, Rat is antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.

Product Name Alternative

BD-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-1-protein-rat.html

Purity

99.00

Smiles

DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS

Molecular Formula

83687 (Gene_ID) O89117 (D33-S69) (Accession)

Molecular Weight

Approximately 7 kDa

References & Citations

[1]Semple F, et al. β-Defensins: multifunctional modulators of infection, inflammation and more? J Innate Immun. 2012;4 (4) :337-48.|[2]Hiratsuka T, et al. Nucleotide sequence and expression of rat beta-defensin-1: its significance in diabetic rodent models. Nephron. 2001 May;88 (1) :65-70.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-P7139-01	BD-3, Rat
HY-P7141-01	BD-4, Rat
HY-169130	Lyso BD-1
HY-P7133-01	BD-1, Human
HY-16996	BD-1047
HY-135608-01	BD-1008
HY-149878-01	BD-9136
HY-171179-01	BD-Oligo
HY-159007	BD-AcAc2
HY-44012-01	SMARCA-BD ligand 1 for PROTAC

Alternative Products

Catalog	Name
BITP2071-01	BD-1
RC260-12	BD-1, rat
OM297038-01	BD 1 Mouse
100-132-L1000	BD-1 (36aa)
100-133	BD-1 (47aa)
T200702-01	Lyso BD-1
Z02754-25	BD-1, Human
OM297036-01	BD 1 Rat
GTR18986490-01	BD 1 Protein
RC444194	Mouse BD-1

BD-1, Rat

Related Products

Alternative Products

Popular Products