BD-4, Rat
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


BD-4, Rat
Description :
BD-4 Protein, Rat is an inducible peptide with a broad spectrum antimicrobial activity.Product Name Alternative :
BD-4 Protein, Rat, Rat, E. coliUNSPSC :
12352202Type :
Recombinant ProteinsAssay Protocol :
https://www.medchemexpress.com/cytokines/bd-4-protein-rat.htmlPurity :
95.0Smiles :
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKKMolecular Formula :
64389 (Gene_ID) O88514 (Q23-K63) (Accession)Molecular Weight :
Approximately 10.8 kDaReferences & Citations :
[1]García JR, et al. Human beta-defensin 4: a novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. FASEB J. 2001 Aug;15 (10) :1819-21.Shipping Conditions :
Room temperature in continental US; may vary elsewhere.Storage Conditions :
Stored at -20°C for 2 yearsScientific Category :
Recombinant Proteins

