Recombinant Mouse IL-1 beta

CAT: 0436-6489Size: 5 µgDry Ice: NoHazardous: No
CAT#:0436-6489Size:5 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.
Synonyms
Mouse ; IL-1 beta
Label
ICT
Type
Recombinant Protein
Source
Yeast
Sequence
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)
Assay Protocol
The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.
Form
Lyophilized
Shipping Conditions
Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping
Storage Temperature
-20°C
Notes
20% discount
Calculated Molecular Weight
17.4 kDa
Target Description
IL-1β is a member of the interleukin 1 family of cytokines. The IL-1 family of cytokines encompasses eleven proteins that each share a similar β-barrel structure and bind to Ig-like receptors. Several of the Well characterized members of the IL-1 cytokines play key roles in the development and regulation of inflammation. IL-1α (IL-1F1), IL-1β (IL-1F2), and IL-18 (IL-1F4) are Well-known inflammatory cytokines active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. In contrast, IL-1 receptor antagonist (IL-1ra; IL-1F3) and IL-36 receptor antagonist (IL-36ra; IL-1F5) reduce inflammation by blocking the binding of the agonist receptor ligands. IL-33 (IL-1F11) is thought to function as an ‘alarmin’ released following cell necrosis to alerting the immune system to tissue damage or stress. The biological properties of IL-37 (IL-1F7) are mainly those of down-regulating inflammation., , The IL-1 beta (IL-1β) cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis.

Related Products

CatalogName
6575Recombinant Human IL-1 beta
6578Recombinant Mouse IL-1 alpha
6576Recombinant Mouse IL-18
6485Recombinant Mouse IL-17A
6496Recombinant Mouse IL-2
6503Recombinant Mouse IL-10
6574Recombinant Mouse IL-34
6520Recombinant Mouse IL-4
6553Recombinant Mouse IL-13
6502Recombinant Mouse IL-6

Alternative Products

CatalogName
P1160-.1Recombinant Mouse IL-1 beta
401-mL-005Recombinant Mouse IL-1 beta/IL-1F2
32-7035-10Recombinant Mouse Interleukin-1 beta/IL-1 beta
PT_41126-01Interleukin-1 beta Mouse Recombinant (IL 1 beta Mouse)
228351IL-1 beta, Recombinant, Mouse (Interleukin 1 beta, IL1B, IL-1F2)
PROTP10749-10ugMouse IL-1 beta /IL-1F2 Recombinant Protein
NBP2-35109-10ugRecombinant Mouse IL-1 beta/IL-1F2 Protein
MF-0133546-01IL-1 beta/IL-1F2 Protein, Mouse, Recombinant
401-mL-025/CFRecombinant Mouse IL-1 beta/IL-1F2 CF
OPSD00152-2UGRecombinant IL-1 beta

Popular Products