Recombinant Mouse IL-10
CAT:
436-6503
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Recombinant Mouse IL-10
- Description: IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Mouse IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.
- Synonyms: Mouse ;IL-10
- Label: ICT
- Type: Recombinant Protein
- Source: Yeast
- Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYL GCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKA VEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)
- Assay Protocol: The Mouse IFN gamma protein can be used in cell culture, as an IFN gamma ELISA Standard, and as a Western Blot Control.
- Form: Lyophilized
- Shipping Conditions: Shipping: Ships at ambient temperature, Ships overnight (domestic), International Priority Shipping
- Storage Temperature: -20°C
- Notes: 20% discount
- Calculated Molecular Weight: 18.8 kDa
- Target Description: IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which consists of nine members: IL-10, IL-19, IL-20, IL-22, IL-24, IL-26, IL-28A, IL-28B, and IL-29. These cytokines elicit diverse host defense mechanisms., , IL-10 family cytokines have indispensable functions in many infectious and inflammatory diseases. IL-10 family cytokines are essential for maintaining the integrity and homeostasis of tissue epithelial layers. By promoting innate immune response, members of this family can limit the damage caused by viral and bacterial infections. They can also facilitate the tissue-healing process in injuries caused by infection or inflammation.