Igf2r Antibody

CAT:
800-RQ4576
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Igf2r Antibody - image 1

Igf2r Antibody

  • Description :

    Insulin-like growth factor 2 receptor, also called IGF2R or I-MPR is a protein that in humans is encoded by the IGF2R gene. This gene is mapped to 6q25.3. This gene encodes a receptor for both insulin-like growth factor 2 and mannose 6-phosphate, although the binding sites for either are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of insulin-like growth factor 2. While the related mouse gene shows exclusive expression from the maternal allele, imprinting of the human gene appears to be polymorphic, with only a minority of individuals showing expression from the maternal allele.
  • Specifications :

    Western blot: 0.5-1 µg/mL, IHC (FFPE) : 1-2 µg/mL
  • UniProt :

    Q07113
  • Host :

    Rabbit
  • Reactivity :

    Mouse, Rat
  • Immunogen :

    Amino acids EKARKGKFRPGQRKPTAPAKLVSFHDDSDEDLLH were used as the immunogen for the Igf2r antibody.
  • Clonality :

    Polyclonal
  • Isotype :

    IgG
  • Applications :

    WB, IHC-P
  • Purity :

    Antigen affinity purified
  • Format :

    Antigen affinity purified
  • Buffer :

    Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
  • Reconstitution :

    After reconstitution, the Igf2r antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Limitations :

    This Igf2r antibody is available for research use only.
  • Storage Conditions :

    After reconstitution, the Igf2r antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Formulation :

    0.5 mg/mL if reconstituted with 0.2ml sterile DI water
  • Applications Notes :

    Optimal dilution of the Igf2r antibody should be determined by the researcher.
  • CAS Number :

    9007-83-4
  • Location :

    Cytoplasmic
  • Image Legend :

    IHC staining of FFPE mouse brain with Igf2r antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.