ATF4 Antibody

• Description :

  ATF4, Activating Transcription Factor 4, is also known as CREB2. ATF4 belongs to the large ATF/CREB family of transcription factors which bind DNA via their basic region and dimerize via their leucine zipper domain to form a variety of homo- and heterodimers to regulate gene transcription. It is identified that members of this family share significant sequence similarity within a leucine zipper DNA-binding motif and an adjacent basic region. The ATF4 gene is mapped to chromosome 22. Unlike CREB, which activates transcription from CRE-containing promoters, CREB2 functions as a specific repressor of CRE-dependent transcription. The transcriptional repressor activity resides within the C-terminal leucine zipper and basic domain region of the CREB2 protein.

• Specifications :

  Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL

• UniProt :

  P18848

• Host :

  Rabbit

• Reactivity :

  Human

• Immunogen :

  Amino acids KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP were used as the immunogen for the ATF4 antibody.

• Clonality :

  Polyclonal

• Isotype :

  IgG

• Applications :

  WB, IHC-P

• Purity :

  Antigen affinity

• Format :

  Antigen affinity purified

• Buffer :

  Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

• Reconstitution :

  After reconstitution, the ATF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

• Limitations :

  This ATF4 antibody is available for research use only.

• Storage Conditions :

  After reconstitution, the ATF4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

• Formulation :

  0.5 mg/mL if reconstituted with 0.2ml sterile DI water

• Applications Notes :

  Optimal dilution of the ATF4 antibody should be determined by the researcher.

• CAS Number :

  9007-83-4

• Location :

  Nuclear, cytoplasmic, cell membrane

• Image Legend :

  IHC testing of FFPE human prostate cancer with ATF4 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.