UCMA, Human

• Description :

  UCMA proteins are key regulators of the complex control of osteogenic differentiation, particularly in the fetal cartilage periphery and at the cartilage-bone interface. Its involvement suggests a crucial role in negatively regulating osteochondral precursor cell differentiation. UCMA Protein, Human is the recombinant human-derived UCMA protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  UCMA Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/ucma-protein-human.html

• Smiles :

  SPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

• Molecular Formula :

  221044 (Gene_ID) Q8WVF2 (S65-T138) (Accession)

• Molecular Weight :

  Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Dry ice.

• Scientific Category :

  Recombinant Proteins