RecombinantTkrA, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantTkrA, Human
Description:
Tyrosine kinase receptor A (Trk-A) is a member of the neurotrophic tyrosine kinase receptor family which includes three members: Trk-A, Trk-B and Trk-C. Trk-A is involved in the development and maturation of the central and peripheral nervous systems through regulation of proliferation, differentiation and survival of sympathetic neurons.Endotoxin:
< 0.2 EU/μg, determined by LAL method.Purity:
> 95% as analyzed by SDS-PAGE.Bioactivity:
ED50 < 1 μg/ml, measured in a neutralization assay in the presence of 10 ng/ml human β-NGF using TF-1 Cells.Reconstitution:
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight:
65~85 kDa, observed by reducing SDS-PAGE.Storage Conditions:
Lyophilized recombinant Human Tyrosine kinase receptor A remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Tyrosine kinase receptor A should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation:
Lyophilized after extensive dialysis against PBS.Host or Source:
HEK 293Recommended Usage:
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.CAS Number:
9000-83-3AA Sequence:
APCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHF TPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGV PTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGR AEVSVQVNVSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTH VNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDP
