Products for Research Use Only
RegisterLogin

RecombinantFasR, Human

CAT: 0384-BK0303-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0303-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 <0.4 μg/ml, measured by its ability to inhibit the cytotoxicity of Jurkat cells in the presence of 20ng/ml of human Fas Ligand.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
17~29 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Fas Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fas Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS

Related Products

CatalogName
BK0354-01RecombinantFGFR-1α (IIIc) -Fc, Human
BK0285-01RecombinantTGF-α, Human
BK0026-01RecombinantEGF, Human
BK0133-01RecombinantMIF, Human
NBP2404Human IL5antibody
IG001-01Human IgG1
BK0352-01RecombinantVEGF165, Human
BK0184-01RecombinantBDNF, Human
BK0180-01RecombinantVEGF121, Human
BK0179-01RecombinantVaspin, Human

Alternative Products

CatalogName
BK0303RecombinantFasR,Human
GTR18990239-01RecombinantFasR, Human
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)

Popular Products