RecombinantTWEAK, Human
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantTWEAK, Human
Description:
TWEAK, short for TNF-related weak inducer of apoptosis, is also known as TNFSF12 and DR3LG. It is a type II transmembrane protein belonging to the TNF superfamily. It is expressed widely in many tissues, such as the heart, skeletal muscle, spleen and peripheral blood. Binding of TWEAK to its receptor TWEAKR induces NF-κB activation, chemokine secretion and apoptosis in certain cell types. TWEAK has also been reported to promote endothelial cell proliferation and migration, thus serving as a regulator of angiogenesis.Endotoxin:
< 0.2 EU/μg, determined by LAL method.Purity:
> 95% as analyzed by SDS-PAGE and HPLC.Bioactivity:
ED50 < 1 ng/ml, measured in a cell cytotoxicity assay using HTB-38 (HT-29) cells.Reconstitution:
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight:
20-22 kDa, observed by reducing SDS-PAGE.Storage Conditions:
Lyophilized recombinant Human TWEAK remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TWEAK should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation:
Lyophilized after extensive dialysis against PBS.Host or Source:
CHORecommended Usage:
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.CAS Number:
9000-83-3AA Sequence:
RKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLK LDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
