Products for Research Use Only
RegisterLogin

RecombinantMIP-1α/CCL3, Mouse

CAT: 0384-BK0322-01Size: 5 μgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0322-01Size:5 μg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1α belongs to the CCL chemokine family, and shares 68% homology with MIP-1β. The mature form of MIP-1α contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1αin vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1β, Interferon-γ, and lipoteichoic acid from gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1α. MIP-1α augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. Additionally, in wounds, MIP-1αchemoattracts macrophages in order to accelerate the tissue repair process.Recombinant Mouse MIP-1 alpha/CCL3 (rmMIP-1α) produced in HEK 293cells is a single polypeptide chain containing 69 amino acids. A fully biologically active molecule, rmMIP-1αhas a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
The EC50 value of mouse MIP-1α/CCL3 on Caˆ2+ mobilization assay in CHO-K1/Gα15/mCCR1 cells (human Gα15 and mouse CCR1 stably expressed in CHO-K1 cells) is less than 100 ng/ml.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
7.8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Mouse MIP-1α/CCL3 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution Mouse MIP-1α/CCL3 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

Related Products

CatalogName
BK0136-01RecombinantMIP-1α/CCL3, Human
BK0270-01RecombinantMIP-1α/CCL3, Human (CHO-expressed)
BK0271-01RecombinantMIP-1β/CCL4, Human
BK0137-01RecombinantMIP-1β/CCL4, Human
BK0138-01RecombinantMIP-2/CXCL2, Mouse
BK0139-01RecombinantMIP-3α/CCL20, Human
BK0324-01RecombinantMIP-3α/CCL20, Rat
BK0140-01RecombinantMIP-5/CCL15 (92aa), Human
BK0320-01RecombinantMCP-1/CCL2, Mouse
CEK1387Mouse CCL3 ELISA Kit

Alternative Products

CatalogName
BK0322RecombinantMIP-1α/CCL3,Mouse
GTR18990220-01RecombinantMIP-1α/CCL3, Mouse
BK0138RecombinantMIP-2/CXCL2,Mouse
GTR18990480-01RecombinantMIP-2/CXCL2, Mouse
Z03270-5MIP-1α/CCL3, Mouse
MBS8575398-01CCL3, Mouse
MBS8229489-01CCL3 siRNA (Mouse)
B2011846Mouse CCL3 Protein
6655Recombinant Mouse CCL3
15367054CCL3 Adenovirus (Mouse)

Popular Products