Products for Research Use Only

RecombinantMIP-3α/CCL20, Rat

CAT: 0384-BK0324-01Size: 5 μgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0324-01Size:5 μg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Macrophage Inflammatory Protein-3 (MIP-3α), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3αis implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3αis expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor.Recombinant rat MIP-3 α/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 α/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of rat MIP-3 α/CCL20 on Caˆ2+ mobilization assay in CHO-K1/ G15/rCCR6 cells (human G15 and rat CCR6 stably expressed in CHO-K1 cells) is less than 0.6 μg/ml.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
8.2 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Rat MIP-3 α/CCL20 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Rat MIP-3 α/CCL20 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
HEK 293
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRIL HLLSLRTKKM