RecombinantM-CSF, Mouse
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantM-CSF, Mouse
Description :
Macrophage-Colony Stimulating Factor (M-CSF), also known as Colony Stimulating Factor-1 (CSF-1), can stimulate the survival, proliferation and differentiation of mononuclear phagocytes, in addition to the spreading and motility of macrophages[1]. M-CSF is mainly produced by monocytes, macrophages, fibroblasts, and endothelial cells[2]. M-CSF interaction with its receptor, c-fms, has been implicated in the growth, invasion, and metastasis of of several diseases, including breast and endometrial cancers [1][3][4] .Endotoxin :
<0.2 EU/μg, determined by LAL method.Purity :
> 95% as analyzed by SDS-PAGE and HPLC.Bioactivity :
ED50< 3 ng/ml, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 3.3x10ˆ5 units/mg.Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight :
35-44 kDa, observed by non-reducing SDS-PAGE.Storage Conditions :
Lyophilized recombinant murine Macrophage-Colony Stimulating Factor (M-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation :
Lyophilized after extensive dialysis against PBS.Host or Source :
CHORecommended Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.CAS Number :
9000-83-3AA Sequence :
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERL QELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

