RecombinantG-CSF, MouseRecombinantG-CSF, Mouse - High-quality laboratory reagent available from Gentaur. Catalog: 384-BK0207-01.384-BK0207-01384-BK0207-01Business & Industrial > Science & LaboratoryRecombinantG-CSF, Mouse
Gentaur
EUR12027-02-21

RecombinantG-CSF, Mouse

CAT:
384-BK0207-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantG-CSF, Mouse - image 1

RecombinantG-CSF, Mouse

  • Description:

    Granulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation.
  • Endotoxin:

    < 0.2 EU/μg, determined by LAL method.
  • Purity:

    > 95% as analyzed by SDS-PAGE and HPLC.
  • Bioactivity:

    ED50 <0.02ng/ml, measured in a cell proliferation assay using NFS-60 cells.
  • Reconstitution:

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight:

    22-24 kDa, observed by reducing SDS-PAGE.
  • Storage Conditions:

    Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance:

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation:

    Lyophilized after extensive dialysis against PBS.
  • Host or Source:

    CHO
  • Recommended Usage:

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • CAS Number:

    9000-83-3
  • AA Sequence:

    VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQC LSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAI SYLQGFLETARLALHHLA