RecombinantG-CSF, Mouse
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantG-CSF, Mouse
Description :
Granulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation.CAS Number :
9000-83-3Endotoxin :
< 0.2 EU/μg, determined by LAL method.Purity :
> 95% as analyzed by SDS-PAGE and HPLC.Bioactivity :
ED50 <0.02ng/ml, measured in a cell proliferation assay using NFS-60 cells.Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight :
22-24 kDa, observed by reducing SDS-PAGE.Storage Conditions :
Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation :
Lyophilized after extensive dialysis against PBS.Host or Source :
CHORecommended Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.AA Sequence :
VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQC LSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAI SYLQGFLETARLALHHLA

