RecombinantGM-CSF, Rat

• Description:

  Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is produced by a number of different cell types, including activated T cells, B cells, macrophages, mast cells, endothelial cells, and fibroblasts, in response to cytokine of immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) is a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. On mature hematopoietic, monocytes/macrophages and eosinophils.

• Endotoxin:

  < 0.2 EU/μg, determined by LAL method.

• Purity:

  > 95% as analyzed by SDS-PAGE and HPLC.

• Bioactivity:

  ED50 < 5 pg/ml, measured in a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of > 2x10ˆ8 units/mg.

• Reconstitution:

  Reconstituted in ddH2O or PBS at 100 μg/ml.

• Molecular Weight:

  16-26 kDa, observed by non-reducing SDS-PAGE.

• Storage Conditions:

  Lyophilized recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rrGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

• Appearance:

  Sterile Filtered White lyophilized (freeze-dried) powder.

• Formulation:

  Lyophilized after extensive dialysis against PBS.

• Host or Source:

  CHO

• Recommended Usage:

  This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

• CAS Number:

  9000-83-3

• AA Sequence:

  APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMI ASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK