RecombinantGM-CSF, Mouse

CAT:
384-BK0212-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantGM-CSF, Mouse - image 1

RecombinantGM-CSF, Mouse

  • Description :

    Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) was initially characterized as a growth factor that can support the in vitro colony formation of granulocyte-macrophage progenitors. It is produced by a number of different cell types (including activated T cells, B cells, macrophages, mast cells, endothelial cells and fibroblasts) in response to cytokine or immune and inflammatory stimuli. Besides granulocyte-macrophage progenitors, GM-CSF is also a growth factor for erythroid, megakaryocyte and eosinophil progenitors. On mature hematopoietic cells, GM-CSF is a survival factor for and activates the effectors functions of granulocytes, monocytes/macrophages and eosinophils.
  • CAS Number :

    9000-83-3
  • Endotoxin :

    <0.2 EU/μg, determined by LAL method.
  • Purity :

    > 95% as analyzed by SDS-PAGE and HPLC.
  • Bioactivity :

    ED50 < 0.05 ng/ml, measured in a cell proliferation assay using mouse FDC-P1 cells, corresponding to a specific activity of >2 x 10ˆ7 units/mg.
  • Reconstitution :

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight :

    15~19 kDa, observed by non-reducing SDS-PAGE.
  • Storage Conditions :

    Lyophilized recombinant murine Granulocyte Macrophage Colony Stimulating Factor (GM-CSF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rmGM-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance :

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation :

    Lyophilized after extensive dialysis against PBS.
  • Host or Source :

    CHO
  • Recommended Usage :

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • AA Sequence :

    APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASY YQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide