RecombinantIL-17A, Mouse

CAT:
384-BK0235-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantIL-17A, Mouse - image 1

RecombinantIL-17A, Mouse

  • Description:

    Interleukin-17A, (also known as CTLA-8) is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. cDNA clones encoding IL-17 have been isolated from activated rat, mouse and human T cells. IL-17 represents a family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. Recombinant murine IL-17A is a 15-20kDa glycosylated cytokine of 133 amino acid polypeptide chain that plays an important role in antimicrobial and chronic inflammation. IL-17 exhibits multiple biological activities on a variety of cells including the induction of IL-6 and IL-8 production in fibroblasts, the enhancement of surface expression of ICAM-1 in fibroblasts, activation of NF-κB and costimulation of T cell proliferation.
  • Endotoxin:

    < 0.2 EU/μg, determined by LAL method.
  • Purity:

    > 95% as analyzed by SDS-PAGE.
  • Bioactivity:

    Measured by its ability to induce IL-1a, IL-4 and IL-6 production by primary mouse splenocytes.
  • Reconstitution:

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight:

    15-22 kDa, observed by reducing SDS-PAGE.
  • Storage Conditions:

    Lyophilized recombinant Murine Interleukin-17A (IL-17A) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant murine IL-17A should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance:

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation:

    Lyophilized after extensive dialysis against PBS.
  • Host or Source:

    CHO
  • Recommended Usage:

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • CAS Number:

    9000-83-3
  • AA Sequence:

    AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNA EGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA