RecombinantIL-12, Mouse
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


RecombinantIL-12, Mouse
Description :
Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals throughtheIL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2.Endotoxin :
< 0.2 EU/μg, determined by LAL method.Purity :
> 95% as analyzed by SDS-PAGE.Bioactivity :
ED50 < 0.15 ng/ml, measured in a cell proliferation assay using 2D6 cells.Reconstitution :
Reconstituted in ddH2O or PBS at 100 μg/ml.Molecular Weight :
27-29 kDa (p35) and 45-50 kDa (p40), observed by reducing SDS-PAGE.Storage Conditions :
Lyophilized recombinant murineInterleukin-12 (IL-12), remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine Interleukin-12 (IL-12), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.Appearance :
Sterile Filtered White lyophilized (freeze-dried) powder.Formulation :
Lyophilized after extensive dialysis against PBS.Host or Source :
CHORecommended Usage :
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.CAS Number :
9000-83-3AA Sequence :
P35: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTT RGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEA DPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA p40: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEF LDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWL VQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEE TLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTP HSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSS CSKWACVPCRVRS

