Products for Research Use Only

RecombinantIL-17A, His, Human

CAT: 0384-BK0234-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0234-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Interleukin-17A (IL-17A), also known as CTLA-8 and IL-17, is a proinflammatory cytokine belonging to the IL-17 family. It is secreted by Th17 cells, gamma/delta T cells, NK cells and neutrophils. IL-17A signals through IL-17 receptor A in a complex with receptor C or D to regulate NF-kappaB and MAP kinase activities. IL-17A plays important roles in the anti-microbial response and chronic inflammation. It stimulates the production of IL-6, IL-8 and G-CSF in epithelial and endothelial cells, and induces the expression of ICAM-1 in fibroblasts. Clinically, IL-17A has been associated with inflammatory diseases, such as rheumatoid arthritis, psoriasis and multiple sclerosis.Recombinant human Interleukin-17A (rhIL-17A) produced in CHO cells is a glycosylated homodimer chain containing 142 amino acids. A fully biologically active molecule, rhIL-17A has a molecular mass of around 14-22 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 0.3 ng/ml, measured in a bioassay using NHDF cells, corresponding to a specific activity of > 3.3x10ˆ6 units/mg.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
14-22 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant humanInterleukin-17A (IL-17A), His remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human Interleukin-17A (IL-17A), His should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAHHHHHH

Popular Products