RecombinantGranzymeB, MouseRecombinantGranzymeB, Mouse - High-quality laboratory reagent available from Gentaur. Catalog: 384-BK0214-01.384-BK0214-01384-BK0214-01Business & Industrial > Science & LaboratoryRecombinantGranzymeB, Mouse
Gentaur
EUR12027-02-20

RecombinantGranzymeB, Mouse

CAT:
384-BK0214-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
RecombinantGranzymeB, Mouse - image 1

RecombinantGranzymeB, Mouse

  • Description:

    Granzyme B is a serine protease most commonly found in the granules of cytotoxic lymphocytes (CTLs), natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also recently been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has been shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodeling.Recombinant Mouse Granzyme B produced in CHO cells is a polypeptide chain containing 227 amino acids. A fully biologically active molecule, rmGranzyme B has a molecular mass of 32 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
  • Endotoxin:

    < 0.2 EU/μg, determined by LAL method.
  • Purity:

    > 98% as analyzed by SDS-PAGE.
  • Bioactivity:

    Measured by its ability to cleave a chromogenic peptide substrate (Ac-IEPD-pNA), the specific activity is greater than 1000 nM/min per μg of enzyme.
  • Reconstitution:

    Reconstituted in ddH2O or PBS at 100 μg/ml.
  • Molecular Weight:

    32 kDa, observed by reducing SDS-PAGE.
  • Storage Conditions:

    Lyophilized recombinant Mouse Granzyme B remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Mouse Granzyme B should be stable up to 1 week at 4°C or up to 2 months at -20°C.
  • Appearance:

    Sterile Filtered White lyophilized (freeze-dried) powder.
  • Formulation:

    Lyophilized after extensive dialysis against PBS.
  • Host or Source:

    CHO
  • Recommended Usage:

    This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
  • CAS Number:

    9000-83-3
  • AA Sequence:

    IIGGHEVKPHSRPYMALLSIKDQQPEAICGGFLIREDFVLTAAHCEGSIINVTLGAHNIK EQEKTQQVIPMVKCIPHPDYNPKTFSNDIMLLKLKSKAKRTRAVRPLNLPRRNVNVKPGD VCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKNRYNKTNQICAGDPKTKRASFR GDSGGPLVCKKVAAGIVSYGYKDGSPPRAFTKVSSFLSWIKKTMKSS