Products for Research Use Only

RecombinantGranzymeB, Mouse

CAT: 0384-BK0214-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0214-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Granzyme B is a serine protease most commonly found in the granules of cytotoxic lymphocytes (CTLs), natural killer cells (NK cells) and cytotoxic T cells. It is secreted by these cells along with the pore forming protein perforin to mediate apoptosis in target cells.Granzyme B has also recently been found to be produced by a wide range of non-cytotoxic cells ranging from basophils and mast cells to smooth muscle cells. The secondary functions of granzyme B are also numerous. Granzyme B has been shown to be involved in inducing inflammation by stimulating cytokine release and is also involved in extracellular matrix remodeling.Recombinant Mouse Granzyme B produced in CHO cells is a polypeptide chain containing 227 amino acids. A fully biologically active molecule, rmGranzyme B has a molecular mass of 32 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
Measured by its ability to cleave a chromogenic peptide substrate (Ac-IEPD-pNA), the specific activity is greater than 1000 nM/min per μg of enzyme.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
32 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Mouse Granzyme B remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, recombinant Mouse Granzyme B should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
IIGGHEVKPHSRPYMALLSIKDQQPEAICGGFLIREDFVLTAAHCEGSIINVTLGAHNIK EQEKTQQVIPMVKCIPHPDYNPKTFSNDIMLLKLKSKAKRTRAVRPLNLPRRNVNVKPGD VCYVAGWGRMAPMGKYSNTLQEVELTVQKDRECESYFKNRYNKTNQICAGDPKTKRASFR GDSGGPLVCKKVAAGIVSYGYKDGSPPRAFTKVSSFLSWIKKTMKSS