RecombinantGDNF, Mouse

• Description:

  Glial-Derived Neurotrophic Factor, also known as GDNF and ATF-1, is a neurotrophic factor belonging to the TGF-beta family. It is expressed in both central nervous system (CNS) and non-CNS tissues. GDNF signals through a receptor system composed of a RET and one of the four GFR alpha receptors. It promotes the survival and differentiation of dopaminergic neurons, and increases their high-affinity dopamine uptake. In a mouse Parkinson’s Disease model, GDNF has been shown to improve bradykinesia, rigidity, and postural instability. GDNF has also been shown to regulate kidney development, spermatogenesis and affect alcohol consumption.

• Endotoxin:

  < 0.2 EU/μg, determined by LAL method.

• Purity:

  > 95% as analyzed by SDS-PAGE and HPLC.

• Bioactivity:

  ED50 <8μg /ml, measured in a bioassay using C6 cells.

• Reconstitution:

  Reconstituted in ddH2O or PBS at 100 μg/ml.

• Molecular Weight:

  17-22 kDa, observed by reducing SDS-PAGE.

• Storage Conditions:

  Lyophilized recombinant murine GDNF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine GDNF should be stable up to 1 week at 4°C or up to 2 months at -20°C.

• Appearance:

  Sterile Filtered White lyophilized (freeze-dried) powder.

• Formulation:

  Lyophilized after extensive dialysis against PBS.

• Host or Source:

  CHO

• Recommended Usage:

  This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

• CAS Number:

  9000-83-3

• AA Sequence:

  MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYD KILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI