Products for Research Use Only
RegisterLogin

RecombinantGCP-2/CXCL6, Human

CAT: 0384-BK0205-01Size: 5 μgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0205-01Size:5 μg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP­2 is most closely related to ENA­78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence) . The structure and sequence of the genes for human GCP­2 and ENA­78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP­2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
9 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human GCP-2/CXCL6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human GCP-2/CXCL6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN

Related Products

CatalogName
CEK1130Human CXCL6 ELISA Kit
BS76683-01CXCL6 polyclonal antibody
BK0275-01RecombinantNAP-2/CXCL7, Human (CHO-expressed)
BK0138-01RecombinantMIP-2/CXCL2, Mouse
BK0143-01RecombinantNAP-2/CXCL7, Rat
BK0010-01RecombinantBMP-2, Human
BK0072-01RecombinantGRO-β/MIP-2/CXCL2, Rat
BK0126-01RecombinantMCP-2/CCL8, Human
BK0215-01RecombinantGRO/MGSA/CXCL1, Human
BK0217-01RecombinantGRO-γ/CXCL3, Human (CHO-expressed)

Alternative Products

CatalogName
GTR18990428-01RecombinantGCP-2/CXCL6, Human
BK0205RecombinantGCP-2/CXCL6,Human
MBS691780-01Human GCP-2 (CXCL6)
Z03700-1GCP-2/CXCL6, Human
E34M163HCXCL6, Human
7153-10GCP-2 (CXCL6), human recombinant
333-GC-025Recombinant Human CXCL6/GCP-2
P6515-5μgRecombinant Human GCP-2/CXCL6
CRH4303-01CXCL6 siRNA (Human)
abx913256-01Human CXCL6 siRNA

Popular Products