Products for Research Use Only
RegisterLogin

RecombinantGCP-2/CXCL6, Human

CAT: 0013-GTR18990428-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990428-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Granulocyte chemotactic protein 2 (GCP-2) also known as Chemokine (C-X-C motif) ligand 6 (CXCL6) is a small cytokine belonging to the CXC chemokine family. As its former name suggests, GCP-2 is a chemoattractant for neutrophilic granulocytes. Among human CXC chemokines, GCP­2 is most closely related to ENA­78 (78% amino acid (aa) sequence identity in the mature peptide region and 86% identity in the signal sequence) . The structure and sequence of the genes for human GCP­2 and ENA­78 also exhibit close similarity suggesting the two genes may have originated from a gene duplication. GCP­2 can signal through the CXCR1 and CXCR2 receptors.Recombinant human GCP-2/CXCL6 produced in CHO cells is a polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhGCP-2/CXCL6 has a molecular mass of 9 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Product Name Alternative
CXCL6, GCP-2
Source
CHO
Field of Research
Immunology & Inflammation
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 98% as analyzed by SDS-PAGE.
Bioactivity
The EC50 value of human GCP-2/CXCL6 on Caˆ2+ mobilization assay in CHO-K1/ Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 0.8 μg/ml.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
9 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human GCP-2°CXCL6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, human GCP-2°CXCL6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKV IQKILDSGNKKN

Related Products

CatalogName
GTR19340706-01CXCL6 siRNA (Human)
GTR18903219-01Human CXCL6 protein
GTR18800691Human CXCL6/GCP-2 ELISA Kit
GTR19033439-01Recombinant Human Granulocyte Chemotactic Protein 2/CXCL6
GTR18090587Mouse Monoclonal human CXCL6 (GCP-2) Antibody
GTR18148292CXCL6 Antibody
GTR18816598-01Human CXCL6 ELISA Kit
GTR18611859CXCL6 Antibody
GTR17889848-01CXCL6 Antibody
GTR18881913-01Human CXCL6 protein (Active)

Alternative Products

CatalogName
BK0205-01RecombinantGCP-2/CXCL6, Human
BK0205RecombinantGCP-2/CXCL6,Human
MBS691780-01Human GCP-2 (CXCL6)
Z03700-1GCP-2/CXCL6, Human
E34M163HCXCL6, Human
7153-10GCP-2 (CXCL6), human recombinant
333-GC-025Recombinant Human CXCL6/GCP-2
P6515-5μgRecombinant Human GCP-2/CXCL6
CRH4303-01CXCL6 siRNA (Human)
abx913256-01Human CXCL6 siRNA

Popular Products