Products for Research Use Only
RegisterLogin

RecombinantGRO/MGSA/CXCL1, Human

CAT: 0384-BK0215-01Size: 5 μgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0384-BK0215-01Size:5 μg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.
CAS Number
9000-83-3
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
Active, measured in a functional assay using HUVEC cells.
Reconstitution
Reconstituted in ddH2O or PBS at 100 μg/ml.
Molecular Weight
~7.8 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human GRO/MGSA/CXCL1 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human GRO/MGSA/CXCL1 should be stable up to 1 week at 4 °C or up to 2 months at -20 °C.
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
Lyophilized after extensive dialysis against PBS.
Host or Source
CHO
Recommended Usage
This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
AA Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Related Products

CatalogName
BK0306-01RecombinantGRO-α/KC/CINC-1/CXCL1, Rat
BK0216-01RecombinantGRO-α/KC/CXCL1, Mouse (CHO-expressed)
PR1036-01Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA (CXCL1) )
BK0217-01RecombinantGRO-γ/CXCL3, Human (CHO-expressed)
BK0071-01RecombinantGRO-β/CINC-3/CXCL2, Rat
BK0072-01RecombinantGRO-β/MIP-2/CXCL2, Rat
BK0069-01RecombinantGROalpha/CXCL1, Human
PR3004-01Recombinant Rat GRO/CXCL1 (rRtGRO/CXCL1)
CEK1123Human CXCL1 ELISA Kit
PR2018-01Recombinant Murine GRO/KC/ CXCL1 (rMuKC/CXCL1)

Alternative Products

CatalogName
BK0215RecombinantGRO/MGSA/CXCL1,Human
MBS692073-01Human GRO-alpha/MGSA (CXCL1)
HECXP-0101Recombinant Human GRO/MGSA (CXCL1)
JOT-PR1036Recombinant Human GRO-alpha/MGSA (rHuGRO-alpha/MGSA(CXCL1) )
MBS692879-01Human GRO-a/MGSA (CXCL1)(Animal Free)
PROTP09341-2Recombinant Human GRO/MGSA (CXCL1) Protein
RC312-12GRO-alpha, GRO, MGSA, (CXCL1), human
G8975-16-01GRO alpha, Recombinant, Human (MGSA, CXCL1)
360361-01GRO-alpha, Recombinant, Human (MGSA, CXCL1) discontinued
rAP-0150GRO-Alpha/MGSA Human Recombinant (CXCL1), His Tag

Popular Products