RecombinantFGF-9, Mouse

• Description:

  Fibroblast Growth Factor-9 (FGF-9), also known as Glia-activating factor (GAF) and HBGF-9, belongs to the heparin-binding growth factors family. It is a secreted protein that exists as monomer or homodimer. It interacts with FGFR-1, FGFR-2, FGFR-3, and FGFR-4 and plays an important role in regulating cell proliferation, differentiation and migration. It is reported that FGF-9 may be involved in glial cell growth and differentiation during development, gliosis during brain tissue regeneration, and glial tumor growth stimulation. Other reports indicate that FGF-9 plays a role in male development.

• Endotoxin:

  < 0.2 EU/μg, determined by LAL method.

• Purity:

  > 95% as analyzed by SDS-PAGE and HPLC.

• Bioactivity:

  ED50 < 2ng/ml, measured in a cell proliferation assay using 3T3 cells.

• Reconstitution:

  Reconstituted in ddH2O or PBS at 100 μg/ml.

• Molecular Weight:

  ~28 kDa, observed by reducing SDS-PAGE.

• Storage Conditions:

  Lyophilized recombinant Murine Fibroblast Growth Factor-9 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Murine Fibroblast Growth Factor-9should be stable up to 1 week at 4°C or up to 2 months at -20°C.

• Appearance:

  Sterile Filtered White lyophilized (freeze-dried) powder.

• Formulation:

  Lyophilized after extensive dialysis against PBS.

• Host or Source:

  CHO

• Recommended Usage:

  This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

• CAS Number:

  9000-83-3

• AA Sequence:

  LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQ GTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYY VALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS