Products for Research Use Only

Noggin Mouse

CAT: 1071-OM301247-02Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM301247-02Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .
Swiss Prot
P97466
Source
Escherichia Coli.
Buffer
Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.
Storage Conditions
Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD