IL17F Mouse

• Description :

  IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa.

• Swiss Prot :

  Q7TNI7

• Source :

  Escherichia Coli.

• Buffer :

  IL17F was lyophilized from a concentrated (1 mg/mL) solution containing no additives.

• Storage Conditions :

  Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities :

  RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP