Noggin Human

• Description:

  Noggin Human Recombinant produced in E.Coli is a non-glycosylated, non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.2 kDa (each chain 23.1 kDa) .

• Swiss Prot:

  Q13253

• Source:

  Escherichia Coli.

• Buffer:

  Lyophilized from a 0.2μm filtered solution in 30% CH3CN, 0.1% TFA.

• Storage Conditions:

  Lyophilized Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPP