Products for Research Use Only

Noggin, Mouse (CHO)

CAT: 0804-HY-P7086-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7086-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Noggin protein is an important BMP inhibitor that plays an indispensable role in the neural tube, somite growth, cartilage morphogenesis, and joint formation. Its homodimeric structure promotes significant interactions with GDF5 and possibly GDF6, inhibiting chondrocyte differentiation. Noggin Protein, Mouse (CHO) is the recombinant mouse-derived Noggin protein, expressed in CHO.
Product Name Alternative
Noggin Protein, Mouse (CHO), Mouse, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/noggin-protein-mouse-cho.html
Purity
97.00
Smiles
LRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Molecular Formula
18121 (Gene_ID) P97466 (L20-C232) (Accession)
Molecular Weight
Approximately 28-31 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Valenzuela DM, et al. Identification of mammalian noggin and its expression in the adult nervous system. J Neurosci. 1995 Sep;15 (9) :6077-84.|[2]Brunet LJ, et al. Noggin, cartilage morphogenesis, and joint formation in the mammalian skeleton. Science. 1998 May 29;280 (5368) :1455-7.|[3]Smith WC, et al. Secreted noggin protein mimics the Spemann organizer in dorsalizing Xenopus mesoderm. Nature. 1993 Feb 11;361 (6412) :547-9.|[4]Groppe J, et al. Structural basis of BMP signalling inhibition by the cystine knot protein Noggin. Nature. 2002 Dec 12;420 (6916) :636-42.|[5]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[6]Matsuura I, et al., BMP inhibition enhances axonal growth and functional recovery after spinal cord injury. J Neurochem. 2008 May;105 (4) :1471-9
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Popular Products