Noggin Mouse

• Description:

  Noggin Mouse Recombinant produced in E.Coli is a non-glycosylated, disulfide-linked protein consisting of two 206 amino acid polypeptide chains, having a total molecular mass of approximately 46.4 kDa (each chain 23.2 kDa) .

• Swiss Prot:

  P97466

• Source:

  Escherichia Coli.

• Buffer:

  Lyophilized from a 0.2?m filtered solution in 30% acetonitrile, 0.1% TFA.

• Storage Conditions:

  Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities:

  MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYD