Products for Research Use Only

Stromatoxin-1 (ScTx1)

CAT: 0466-SCT01-00100Size: 0.1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0466-SCT01-00100Size:0.1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Stromatoxin-1 (ScTx-1) has been isolated from the venom of the African tarentula Stromatopelma calceata.Stromatoxin-1 is a 34 amino-acid long peptide that belongs to the structural family of inhibitor cystine knot peptides reticulated by three disulfide bridges. It has an amidated C-terminus and bears strong homology with hanatoxin 1 (83%) .Stromatoxin-1 inhibits with high affinities Kv2.1 and Kv2.2, that encode delayed K+ channels (respectively, with IC50 of 12 and 21 nM) . The block is voltage-dependent and slowly reversible. Stromatoxin-1 is also a very sensitive inhibitor of Kv4.2, that encodes a transient K+ current (IC50 of 1.2 nM) . Here also, the block is voltage-dependent indicating that ScTx-1 acts as a gating modifier rather than a pore blocker. Reversibility is faster on Kv4.2 channels. In contrast, Stromatoxin-1 has no effect on Kv1.1, Kv1.2, Kv1.3, Kv1.4, Kv1.5, Kv1.6 or Kv3.4 channels. The toxin has also no effect on voltage-dependent Na+ and Ca2+ channels of cerebellar granule cells. Stromatoxin-1 was found to increase the spontaneous phasic contraction amplitude, muscle force and tone in isolated rat urinary bladder smooth muscle. It also enhances myogenic constriction in pressurized arterial segments.
Specifications
Blocker of Kv2 channels
Target
K channels
Sequence
DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI
Peptide Number
SCT01
Disulfide Bonds
Cys2-Cys16; Cys9-Cys21; Cys15-Cys28
N Terminal Sequence
H
C Terminal Sequence
NH2