Norrin, Mouse

CAT:
804-HY-P79131-01
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Norrin, Mouse - image 1

Norrin, Mouse

  • Description :

    Norrin protein is a key component of the canonical Wnt signaling pathway, activating the cascade by interacting with the FZD4 receptor and LRP5 coreceptor. Its role in retinal vascularization includes serving as a FZD4 ligand, stabilizing β-catenin (CTNNB1), and initiating LEF/TCF-mediated transcription. Norrin Protein, Mouse is the recombinant mouse-derived Norrin protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    Norrin Protein, Mouse, Mouse, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/norrin-protein-mouse.html
  • Purity :

    97.00
  • Smiles :

    KTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS
  • Molecular Formula :

    17986 (Gene_ID) P48744 (K25-S131) (Accession)
  • Molecular Weight :

    Approximately 13 kDa
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide