Norrin, Human

• Description :

  Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1) . It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  Norrin Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/norrin-protein-human.html

• Purity :

  96.0

• Smiles :

  KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

• Molecular Formula :

  4693 (Gene_ID) Q00604 (K25-S133) (Accession)

• Molecular Weight :

  Approximately 13 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins