Products for Research Use Only
RegisterLogin

VEGF120, Mouse

CAT: 0804-HY-P72775-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72775-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
VEGF-A Protein is a key member of the VEGF family of cytokines.VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability.VEGF-A stimulates endothelial cell mitogenesis and cell migration.VEGF120 Protein, Mouse is the recombinant mouse-derived VEGF120 protein, expressed by E.coli , with tag free.
Product Name Alternative
VEGF120 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/vegf120-protein-mouse.html
Purity
96.00
Smiles
APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Molecular Formula
22339 (Gene_ID) Q00731-3 (A27-R146) (Accession)
Molecular Weight
Approximately 17 kDa under reduced (R) conditions, 36 kDa under non reducing (N) conditions, based on SDS-PAGE.
References & Citations
[1]He W, et al. CMT2D neuropathy is linked to the neomorphic binding activity of glycyl-tRNA synthetase. Nature. 2015 Oct 29;526 (7575) :710-4.|[2]Herrera VL, et al. Embryonic lethality in Dear gene-deficient mice: new player in angiogenesis. Physiol Genomics. 2005 Nov 17;23 (3) :257-68.|[3]Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25 (1) :1-19.|[4]Murphy JF, et al. Vascular endothelial growth factor induces cyclooxygenase-dependent proliferation of endothelial cells via the VEGF-2 receptor. FASEB J. 2001 Jul;15 (9) :1667-9.|[5]Dixelius J, et al. Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein. Cancer Res. 2006 Feb 15;66 (4) :2089-97.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7312-01VEGF164, Mouse
HY-P7421-01VEGF164, Mouse (P.pastoris)
HY-P70761-01VEGF164, Mouse (164a.a, P.pastoris)
HY-P78814-01VEGF164, Mouse (Biotinylated, HEK293, His-Avi)
HY-P7420-01VEGF121, Human (120 a.a)
HY-P73471-01VEGF121, Human (HEK293)
HY-P703971-01VEGF110, Human (HEK293)
HY-P70519-01VEGF121, Human (HEK293, His)
HY-P704409VEGF121 , Human (HEK293, N-His)
HY-P78377VEGF121, Human (HEK293, His-Avi)

Alternative Products

CatalogName
MBS691724-01Mouse VEGF120
Z02779-10VEGF120, Mouse
PRP1134-01Mouse VEGF120 Protein
NBP2-35188-10ugRecombinant Mouse VEGF120 Protein
P1180-.5Recombinant Mouse VEGF120, Yeast
AR26013PU-SVEGF-A (VEGF120) Mouse Protein
VE0-M4211-50ugMouse VEGF120 Protein, Tag Free
7424-10Human CellExp™ VEGF120, mouse recombinant
VE0-M82Q2-25ugBiotinylated Mouse VEGF120 Protein, His, Avitag™
RC236-17VEGF120, Vascular Endothelial Growth Factor 120, murine (mouse)

Popular Products