VEGF164, Mouse

• Description :

  VEGF164 Protein, Mouse is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

• Product Name Alternative :

  VEGF164 Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/vegf165-protein-mouse.html

• Purity :

  98.0

• Smiles :

  MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

• Molecular Formula :

  22339 (Gene_ID) Q00731-2 (A27-R190) (Accession)

• Molecular Weight :

  Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]Usui T, et al. VEGF164 (165) as the pathological isoform: differential leukocyte and endothelial responses through VEGFR1 and VEGFR2. Invest Ophthalmol Vis Sci. 2004 Feb;45 (2) :368-74.|[2]Ishida S, et al. VEGF164 is proinflammatory in the diabetic retina. Invest Ophthalmol Vis Sci. 2003 May;44 (5) :2155-62.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins