SHH, Mouse

• Description :

  SHH Protein, Mouse is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.

• Product Name Alternative :

  SHH Protein, Mouse, Mouse, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Applications :

  Neuroscience-Neuromodulation

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/shh-protein-mouse.html

• Purity :

  98.0

• Smiles :

  IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

• Molecular Formula :

  20423 (Gene_ID) Q62226 (C25-G198, C25I-V-I) (Accession)

• Molecular Weight :

  Approximately 19.8 kDa, based on SDS-PAGE under reducing conditions.

• References & Citations :

  [1]De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73 (2) :291-303.|[2]Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43 (5) :1813-1828.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins