PR-Set7, Human

• Description :

  The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  PR-Set7 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/pr-set7-protein-human.html

• Purity :

  96.00

• Smiles :

  KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

• Molecular Formula :

  387893 (Gene_ID) Q9NQR1-2/NP_065115 (K195-H352) (Accession)

• Molecular Weight :

  Approximately 18 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins