IP-10 (CXCL10) Recombinant Protein
CAT:
209-M10-025
Size:
25 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

IP-10 (CXCL10) Recombinant Protein
- Description: Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.
- Synonyms: Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
- CAS Number: 9000-83-3
- NCBI Gene ID: 15945
- UniProt: P17515
- Accession Number: NP_067249.1
- Accession Number mRNA: NM_021274.2
- Gene Location: 5 E2; 5 53.0 cM
- Host: E. coli
- Origin Species: Mouse
- Species Reactivity: Human, Mouse, Rat, Monkey
- Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
- Detection Range: Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98% by SDS-PAGE & HPLC analyses
- Length: 77
- Form: Lyophilized
- Molecular Weight: 8.7 kDa
- Shipping Conditions: Room Temperature