Login

IP-10 (CXCL10) Recombinant Protein

CAT:
209-M10-025S
Size:
5 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
IP-10 (CXCL10) Recombinant Protein - image 1

IP-10 (CXCL10) Recombinant Protein

  • Description: Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.
  • Synonyms: Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
  • CAS Number: 9000-83-3
  • NCBI Gene ID: 15945
  • UniProt: P17515
  • Accession Number: NP_067249.1
  • Accession Number mRNA: NM_021274.2
  • Gene Location: 5 E2; 5 53.0 cM
  • Host: E. coli
  • Origin Species: Mouse
  • Species Reactivity: Human, Mouse, Rat, Monkey
  • Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
  • Detection Range: Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.
  • Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
  • Purity: > 98% by SDS-PAGE & HPLC analyses
  • Length: 77
  • Form: Lyophilized
  • Molecular Weight: 8.7 kDa
  • Shipping Conditions: Room Temperature