IP-10 (CXCL10) Recombinant Protein

IP-10 (CXCL10) Recombinant Protein

• Description: Murine IP-10 is produced by several cell types during the delayed type hypersensitivity response. IP-10 acts as a chemoattractant towards monocytes, lymphocytes, and certain T cells. Recombinant Murine IP-10 is a 8.7 kDa protein, containing 77 amino acid residues.
• Synonyms: Cxcl10; C7; IP10; CRG-2; INP10; IP-10; Ifi10; mob-1; Scyb10; gIP-10
• CAS Number: 9000-83-3
• NCBI Gene ID: 15945
• UniProt: P17515
• Accession Number: NP_067249.1
• Accession Number mRNA: NM_021274.2
• Gene Location: 5 E2; 5 53.0 cM
• Host: E. coli
• Origin Species: Mouse
• Species Reactivity: Human, Mouse, Rat, Monkey
• Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
• Detection Range: Assay #1: Determined by its ability to chemoattract IL-2 activated T cells using a concentration range of 0.1-10.0 ng/ml. Assay #2: Determined by its ability to chemoattract CXCR3 transfected/HEK293 cells using a concentration range of 100-500 ng/ml.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98% by SDS-PAGE & HPLC analyses
• Length: 77
• Form: Lyophilized
• Molecular Weight: 8.7 kDa
• Shipping Conditions: Room Temperature