IP-10 (CXCL10) Recombinant Protein
CAT:
209-100-057
Size:
25 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

IP-10 (CXCL10) Recombinant Protein
- Description: IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
- Synonyms: CXCL10
- CAS Number: 9000-83-3
- NCBI Gene ID: 3627
- UniProt: P02778
- Accession Number: NP_001556.2
- Accession Number mRNA: NM_001565.3
- Gene Location: 4q21
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Monkey, Mouse, Leech, Human
- Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Detection Range: Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 98% by SDS-PAGE & HPLC analyses
- Length: 77
- Form: Lyophilized
- Molecular Weight: 8.6 kDa
- Shipping Conditions: Room Temperature