IP-10 (CXCL10) Recombinant Protein

IP-10 (CXCL10) Recombinant Protein

• Description: IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
• Synonyms: CXCL10
• CAS Number: 9000-83-3
• NCBI Gene ID: 3627
• UniProt: P02778
• Accession Number: NP_001556.2
• Accession Number mRNA: NM_001565.3
• Gene Location: 4q21
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Monkey, Mouse, Leech, Human
• Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
• Detection Range: Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 98% by SDS-PAGE & HPLC analyses
• Length: 77
• Form: Lyophilized
• Molecular Weight: 8.6 kDa
• Shipping Conditions: Room Temperature